Lineage for d4egff_ (4egf F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581064Species Mycobacterium smegmatis [TaxId:246196] [189539] (5 PDB entries)
  8. 1581082Domain d4egff_: 4egf F: [220503]
    automated match to d3pk0b_

Details for d4egff_

PDB Entry: 4egf (more details), 2.3 Å

PDB Description: crystal structure of a l-xylulose reductase from mycobacterium smegmatis
PDB Compounds: (F:) L-xylulose reductase

SCOPe Domain Sequences for d4egff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egff_ c.2.1.0 (F:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dryagvlrldgkralitgatkgigadiarafaaagarlvlsgrdvseldaarralgeqfg
tdvhtvaidlaepdapaelarraaeafggldvlvnnagishpqpvvdtdpqlfdatiavn
lrapallasavgkamvaageggaiitvasaaalaplpdhyayctskaglvmatkvlarel
gphgiransvcptvvltemgqrvwgdeaksapmiariplgrfavphevsdavvwlasdaa
smingvdipvdggytmg

SCOPe Domain Coordinates for d4egff_:

Click to download the PDB-style file with coordinates for d4egff_.
(The format of our PDB-style files is described here.)

Timeline for d4egff_: