Lineage for d4egab1 (4ega B:237-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106228Species Trypanosoma brucei [TaxId:999953] [226467] (27 PDB entries)
  8. 2106234Domain d4egab1: 4ega B:237-606 [220496]
    Other proteins in same PDB: d4egaa2, d4egab2, d4egab3
    automated match to d1rqga2
    protein/RNA complex; complexed with 0p8, dms, gol, met, so4

Details for d4egab1

PDB Entry: 4ega (more details), 2.7 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor chem 1320
PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d4egab1:

Sequence, based on SEQRES records: (download)

>d4egab1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerl
lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld
altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl
plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk
nmiarlngel

Sequence, based on observed residues (ATOM records): (download)

>d4egab1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpqnitdckvslesghvvtwvseenymfrlsafrerllewyhanp
gcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltnyltg
srlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkkiva
hgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlng
el

SCOPe Domain Coordinates for d4egab1:

Click to download the PDB-style file with coordinates for d4egab1.
(The format of our PDB-style files is described here.)

Timeline for d4egab1: