SCOPe 2.03: Domain d4egaa2: 4ega A:607-768

Lineage for d4egaa2 (4ega A:607-768)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (6 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226468] (5 PDB entries)

8. Domain d4egaa2: 4ega A:607-768 [220495]
   Other proteins in same PDB: d4egaa1, d4egab1
   automated match to d1rqga1
   protein/RNA complex; complexed with 0p8, dms, gol, met, so4

Details for d4egaa2

PDB Entry: 4ega, 2.7 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor chem 1320

PDB Compounds: (A:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d4egaa2:

Sequence; same for both SEQRES and ATOM records:

>d4egaa2 a.27.1.0 (A:607-768) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste

Timeline for d4egaa2:

• d4egaa2 is new in SCOPe 2.03-stable
  
• d4egaa2 appears in SCOPe 2.04
  
• d4egaa2 appears in the current release, SCOPe 2.08