Lineage for d1pgrf1 (1pgr F:1-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297328Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1297329Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1297540Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)
  7. 1297544Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 1297553Domain d1pgrf1: 1pgr F:1-106 [22049]
    Other proteins in same PDB: d1pgra_, d1pgrc_, d1pgre_, d1pgrg_

Details for d1pgrf1

PDB Entry: 1pgr (more details), 3.5 Å

PDB Description: 2:2 complex of g-csf with its receptor
PDB Compounds: (F:) protein (g-csf receptor)

SCOPe Domain Sequences for d1pgrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgrf1 b.1.2.1 (F:1-106) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdv

SCOPe Domain Coordinates for d1pgrf1:

Click to download the PDB-style file with coordinates for d1pgrf1.
(The format of our PDB-style files is described here.)

Timeline for d1pgrf1: