Lineage for d4eg2e1 (4eg2 E:1-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918813Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2918814Protein automated matches [190746] (16 species)
    not a true protein
  7. 2918880Species Vibrio cholerae [TaxId:666] [226364] (1 PDB entry)
  8. 2918889Domain d4eg2e1: 4eg2 E:1-150 [220480]
    Other proteins in same PDB: d4eg2a3, d4eg2b3, d4eg2c3, d4eg2d3, d4eg2e3, d4eg2f3, d4eg2g3, d4eg2h3
    automated match to d1alna1
    complexed with act, mg, uri, zn

Details for d4eg2e1

PDB Entry: 4eg2 (more details), 2.2 Å

PDB Description: 2.2 angstrom crystal structure of cytidine deaminase from vibrio cholerae in complex with zinc and uridine
PDB Compounds: (E:) Cytidine deaminase

SCOPe Domain Sequences for d4eg2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eg2e1 c.97.1.0 (E:1-150) automated matches {Vibrio cholerae [TaxId: 666]}
mrnrieqalqqmpasfapylrelvlakdfdatfsaeqyqqlltlsgledadlrvallpia
aaysyapisefyvgaivrgisgrlylganmeftgaqlgqtvhaeqcaishawmkgekgva
ditinfspcghcrqfmnelttasslkiqlp

SCOPe Domain Coordinates for d4eg2e1:

Click to download the PDB-style file with coordinates for d4eg2e1.
(The format of our PDB-style files is described here.)

Timeline for d4eg2e1: