![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
![]() | Protein automated matches [190746] (16 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [226364] (1 PDB entry) |
![]() | Domain d4eg2a1: 4eg2 A:1-150 [220472] Other proteins in same PDB: d4eg2a3, d4eg2b3, d4eg2c3, d4eg2d3, d4eg2e3, d4eg2f3, d4eg2g3, d4eg2h3 automated match to d1alna1 complexed with act, mg, uri, zn |
PDB Entry: 4eg2 (more details), 2.2 Å
SCOPe Domain Sequences for d4eg2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eg2a1 c.97.1.0 (A:1-150) automated matches {Vibrio cholerae [TaxId: 666]} mrnrieqalqqmpasfapylrelvlakdfdatfsaeqyqqlltlsgledadlrvallpia aaysyapisefyvgaivrgisgrlylganmeftgaqlgqtvhaeqcaishawmkgekgva ditinfspcghcrqfmnelttasslkiqlp
Timeline for d4eg2a1: