Lineage for d4eg0a2 (4eg0 A:103-311)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217694Species Burkholderia ambifaria [TaxId:398577] [226366] (1 PDB entry)
  8. 2217695Domain d4eg0a2: 4eg0 A:103-311 [220467]
    Other proteins in same PDB: d4eg0a1, d4eg0b1
    automated match to d1e4ea2
    complexed with edo

Details for d4eg0a2

PDB Entry: 4eg0 (more details), 1.65 Å

PDB Description: Crystal Structure of D-alanine--D-alanine ligase from Burkholderia ambifaria
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4eg0a2:

Sequence, based on SEQRES records: (download)

>d4eg0a2 d.142.1.0 (A:103-311) automated matches {Burkholderia ambifaria [TaxId: 398577]}
dkfrtklvwqqtgvptppfetvmrgddyaaratdivaklglplfvkpasegssvavlkvk
tadalpaalseaathdkiviveksiegggeytaciagdldlplikivpagefydyhakyv
andtqylipcglpaeqetelkriarrafdvlgctdwgradfmldaagnayflevntapgm
tdhslppkaarsigigyselvvkvlsltl

Sequence, based on observed residues (ATOM records): (download)

>d4eg0a2 d.142.1.0 (A:103-311) automated matches {Burkholderia ambifaria [TaxId: 398577]}
dkfrtklvwqqtgvptppfetvmrgddyaaratdivaklglplfvkpasavlkvktadal
paalseaathdkiviveksiegggeytaciagdldlplikivptqylipcglpaeqetel
kriarrafdvlgctdwgradfmldaagnayflevntapgmtdhslppkaarsigigysel
vvkvlsltl

SCOPe Domain Coordinates for d4eg0a2:

Click to download the PDB-style file with coordinates for d4eg0a2.
(The format of our PDB-style files is described here.)

Timeline for d4eg0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eg0a1