SCOPe 2.03: Domain d4eg0a1: 4eg0 A:4-102

Lineage for d4eg0a1 (4eg0 A:4-102)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (19 species)
   not a true protein

7. Species Burkholderia ambifaria [TaxId:398577] [226365] (1 PDB entry)

8. Domain d4eg0a1: 4eg0 A:4-102 [220466]
   Other proteins in same PDB: d4eg0a2, d4eg0b2
   automated match to d1e4ea1
   complexed with edo

Details for d4eg0a1

PDB Entry: 4eg0, 1.65 Å

PDB Description: Crystal Structure of D-alanine--D-alanine ligase from Burkholderia ambifaria

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4eg0a1:

Sequence; same for both SEQRES and ATOM records:

>d4eg0a1 c.30.1.0 (A:4-102) automated matches {Burkholderia ambifaria [TaxId: 398577]}
idpkrfgkvavlfggesaerevsltsgrlvlqglrdagidahpfdpaerplsalkdegfv
rafnalhggygengqiqgaldfygirytgsgvlgsalgl

Timeline for d4eg0a1:

• d4eg0a1 is new in SCOPe 2.03-stable
  
• d4eg0a1 appears in SCOPe 2.04
  
• d4eg0a1 appears in the current release, SCOPe 2.08