Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (19 species) not a true protein |
Species Burkholderia ambifaria [TaxId:398577] [226365] (1 PDB entry) |
Domain d4eg0a1: 4eg0 A:4-102 [220466] Other proteins in same PDB: d4eg0a2, d4eg0b2 automated match to d1e4ea1 complexed with edo |
PDB Entry: 4eg0 (more details), 1.65 Å
SCOPe Domain Sequences for d4eg0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eg0a1 c.30.1.0 (A:4-102) automated matches {Burkholderia ambifaria [TaxId: 398577]} idpkrfgkvavlfggesaerevsltsgrlvlqglrdagidahpfdpaerplsalkdegfv rafnalhggygengqiqgaldfygirytgsgvlgsalgl
Timeline for d4eg0a1: