SCOPe 2.07: Domain d4efha2: 4efh A:147-374

Lineage for d4efha2 (4efh A:147-374)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Acanthamoeba castellanii [TaxId:5755] [226350] (1 PDB entry)

8. Domain d4efha2: 4efh A:147-374 [220465]
   Other proteins in same PDB: d4efha1
   automated match to d1c0fa2
   complexed with adp, ca

Details for d4efha2

PDB Entry: 4efh, 2.48 Å

PDB Description: Acanthamoeba Actin complex with Spir domain D

PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d4efha2:

Sequence; same for both SEQRES and ATOM records:

>d4efha2 c.55.1.1 (A:147-374) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
rttgivldsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemhtaasssaleksyelpdgqvitignerfrapealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmqkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkc

Timeline for d4efha2:

• d4efha2 first appeared in SCOPe 2.03
  
• d4efha2 appears in SCOPe 2.06
  
• d4efha2 appears in the current release, SCOPe 2.08