Lineage for d1pgrb2 (1pgr B:108-213)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54816Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species)
  7. 54817Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 54823Domain d1pgrb2: 1pgr B:108-213 [22046]
    Other proteins in same PDB: d1pgra_, d1pgrc_, d1pgre_, d1pgrg_

Details for d1pgrb2

PDB Entry: 1pgr (more details), 3.5 Å

PDB Description: 2:2 complex of g-csf with its receptor

SCOP Domain Sequences for d1pgrb2:

Sequence, based on SEQRES records: (download)

>d1pgrb2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
kleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhl
psskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptm

Sequence, based on observed residues (ATOM records): (download)

>d1pgrb2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
kleppmlqaldigpdqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpssk
dqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptm

SCOP Domain Coordinates for d1pgrb2:

Click to download the PDB-style file with coordinates for d1pgrb2.
(The format of our PDB-style files is described here.)

Timeline for d1pgrb2: