![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins) |
![]() | Protein automated matches [190297] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187395] (19 PDB entries) |
![]() | Domain d4eegb_: 4eeg B: [220455] automated match to d2agda_ complexed with gol, mn, so4, udp |
PDB Entry: 4eeg (more details), 2.2 Å
SCOPe Domain Sequences for d4eegb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eegb_ c.68.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn nywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtket mlsdglnsltyqvldvqryplytqitvdigtps
Timeline for d4eegb_: