Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins) |
Protein automated matches [190297] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187395] (19 PDB entries) |
Domain d4eega_: 4eeg A: [220454] automated match to d2agda_ complexed with gal, gol, mn, nag, so4, udp |
PDB Entry: 4eeg (more details), 2.2 Å
SCOPe Domain Sequences for d4eega_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eega_ c.68.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn nywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtket mlsdglnsltyqvldvqryplytqitvdigtps
Timeline for d4eega_: