SCOPe 2.07: Domain d4eeab_: 4eea B:

Lineage for d4eeab_ (4eea B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)

6. Protein automated matches [190297] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187395] (19 PDB entries)

8. Domain d4eeab_: 4eea B: [220452]
   automated match to d2agda_
   complexed with bgc, gal, gol, mn, nag, so4, udp

Details for d4eeab_

PDB Entry: 4eea, 2 Å

PDB Description: crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with glcnac-beta1,6-gal-beta1,4-glc-beta

PDB Compounds: (B:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d4eeab_:

Sequence; same for both SEQRES and ATOM records:

>d4eeab_ c.68.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
nywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtket
mlsdglnsltyqvldvqryplytqitvdigtps

Timeline for d4eeab_:

• d4eeab_ first appeared in SCOPe 2.03
  
• d4eeab_ appears in SCOPe 2.06
  
• d4eeab_ appears in the current release, SCOPe 2.08