SCOPe 2.08: Domain d4ee6b_: 4ee6 B:

Lineage for d4ee6b_ (4ee6 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.313: Antiparallel beta/alpha barrel (PT-barrel) [143491] (1 superfamily)
   tandem repeat of five alpha(2)-beta(2) motifs; antiparallel beta-sheet barrel, closed; n=10, S=10; order 123456789A; there is a channel along the barrel axis

4. Superfamily d.313.1: Prenyltransferase-like [143492] (2 families)
   the barrel channel harbours the substrate-binding site

5. Family d.313.1.0: automated matches [193384] (1 protein)
   not a true family

6. Protein automated matches [193385] (1 species)
   not a true protein

7. Species Streptomyces cinnamonensis [TaxId:1900] [193386] (3 PDB entries)

8. Domain d4ee6b_: 4ee6 B: [220448]
   automated match to d4ee7a_
   complexed with cl, mg, pg4

Details for d4ee6b_

PDB Entry: 4ee6, 1.33 Å

PDB Description: crystal structure of the novel phenazine prenyltransferase epzp (methylated)

PDB Compounds: (B:) Prenyltransferase

SCOPe Domain Sequences for d4ee6b_:

Sequence; same for both SEQRES and ATOM records:

>d4ee6b_ d.313.1.0 (B:) automated matches {Streptomyces cinnamonensis [TaxId: 1900]}
msesadltelysiiektaqvvdvtashdkvwpilnafqdviadsvisfrastgssaddld
crftmlpkgldpyaralehgltpktdhpvgsllkevhenlpitscgvdfgvaggftktws
fpsaeklgkvselvklpsipdavaanrdffekwgiadmvstvgidyskrtmnlyfgggvg
drvpagvfeekgvrailgelglaapseellkfcersfviyvtlswdspkinrftysvmtp
eplglpvdlaptferliksapydtegrnyvygiastpkgeyhkiasyyqwq

Timeline for d4ee6b_:

• d4ee6b_ first appeared in SCOPe 2.03
  
• d4ee6b_ appears in SCOPe 2.07