Lineage for d1cd9d2 (1cd9 D:108-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9856Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species)
  7. 9857Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 9861Domain d1cd9d2: 1cd9 D:108-213 [22044]
    Other proteins in same PDB: d1cd9a_, d1cd9c_

Details for d1cd9d2

PDB Entry: 1cd9 (more details), 2.8 Å

PDB Description: 2:2 complex of g-csf with its receptor

SCOP Domain Sequences for d1cd9d2:

Sequence, based on SEQRES records: (download)

>d1cd9d2 b.1.2.1 (D:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
kleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhl
psskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptm

Sequence, based on observed residues (ATOM records): (download)

>d1cd9d2 b.1.2.1 (D:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
kleppmlqaldqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqfe
lcglhqapvytlqmrcirsslpgfwspwspglqlrptm

SCOP Domain Coordinates for d1cd9d2:

Click to download the PDB-style file with coordinates for d1cd9d2.
(The format of our PDB-style files is described here.)

Timeline for d1cd9d2: