Lineage for d4edzc1 (4edz C:2-75)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879690Domain d4edzc1: 4edz C:2-75 [220430]
    Other proteins in same PDB: d4edza2, d4edzb2, d4edzb3, d4edzc2, d4edzd2, d4edzd3
    automated match to d1pd212
    complexed with 0o5, gsh, mg

Details for d4edzc1

PDB Entry: 4edz (more details), 2 Å

PDB Description: Crystal structure of hH-PGDS with water displacing inhibitor
PDB Compounds: (C:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4edzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4edzc1 c.47.1.0 (C:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d4edzc1:

Click to download the PDB-style file with coordinates for d4edzc1.
(The format of our PDB-style files is described here.)

Timeline for d4edzc1: