| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
| Domain d4edzb1: 4edz B:2-75 [220428] Other proteins in same PDB: d4edza2, d4edzb2, d4edzb3, d4edzc2, d4edzd2, d4edzd3 automated match to d1pd212 complexed with 0o5, gsh, mg |
PDB Entry: 4edz (more details), 2 Å
SCOPe Domain Sequences for d4edzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4edzb1 c.47.1.0 (B:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt
Timeline for d4edzb1: