Lineage for d4edza2 (4edz A:76-199)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713592Domain d4edza2: 4edz A:76-199 [220427]
    Other proteins in same PDB: d4edza1, d4edzb1, d4edzb3, d4edzc1, d4edzd1, d4edzd3
    automated match to d1pd211
    complexed with 0o5, gsh, mg

Details for d4edza2

PDB Entry: 4edz (more details), 2 Å

PDB Description: Crystal structure of hH-PGDS with water displacing inhibitor
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4edza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4edza2 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d4edza2:

Click to download the PDB-style file with coordinates for d4edza2.
(The format of our PDB-style files is described here.)

Timeline for d4edza2: