SCOPe 2.06: Domain d4edya1: 4edy A:2-75

Lineage for d4edya1 (4edy A:2-75)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)

8. Domain d4edya1: 4edy A:2-75 [220422]
   Other proteins in same PDB: d4edya2, d4edyb2, d4edyb3
   automated match to d1pd212
   complexed with 9pq, dms, gsh, mg

Details for d4edya1

PDB Entry: 4edy, 1.72 Å

PDB Description: Crystal structure of hH-PGDS with water displacing inhibitor

PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4edya1:

Sequence; same for both SEQRES and ATOM records:

>d4edya1 c.47.1.0 (A:2-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d4edya1:

• d4edya1 first appeared in SCOPe 2.03
  
• d4edya1 appears in SCOPe 2.05
  
• d4edya1 appears in SCOPe 2.07
  
• d4edya1 appears in the current release, SCOPe 2.08