Lineage for d1cd9b2 (1cd9 B:108-213)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105325Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species)
  7. 105326Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 105328Domain d1cd9b2: 1cd9 B:108-213 [22042]
    Other proteins in same PDB: d1cd9a_, d1cd9c_

Details for d1cd9b2

PDB Entry: 1cd9 (more details), 2.8 Å

PDB Description: 2:2 complex of g-csf with its receptor

SCOP Domain Sequences for d1cd9b2:

Sequence, based on SEQRES records: (download)

>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
kleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhl
psskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptm

Sequence, based on observed residues (ATOM records): (download)

>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
kleppmlqaldiqpgclwlswkpwkpseymeqecelryqpqlkganwtlvfhlpsskdqf
elcglhqapvytlqmrcirsslpgfwspwspglqlrptm

SCOP Domain Coordinates for d1cd9b2:

Click to download the PDB-style file with coordinates for d1cd9b2.
(The format of our PDB-style files is described here.)

Timeline for d1cd9b2: