Lineage for d4ecja2 (4ecj A:82-203)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714163Species Pseudomonas aeruginosa [TaxId:388272] [226355] (3 PDB entries)
  8. 2714165Domain d4ecja2: 4ecj A:82-203 [220419]
    Other proteins in same PDB: d4ecja1, d4ecja3, d4ecjb1, d4ecjb3
    automated match to d1k0db1
    complexed with gsh

Details for d4ecja2

PDB Entry: 4ecj (more details), 1.76 Å

PDB Description: Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4ecja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ecja2 a.45.1.0 (A:82-203) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
lmpadvkgrsrviqwlmfqmggvgpmqgqanvffryfpeklqgaidryqhetrrlyevld
grlgeaeylagdysiadiatypwvrihdwsgvavdgldnlqrwiaaiearpavqrgllvp
rr

SCOPe Domain Coordinates for d4ecja2:

Click to download the PDB-style file with coordinates for d4ecja2.
(The format of our PDB-style files is described here.)

Timeline for d4ecja2: