Lineage for d4ecia2 (4eci A:82-203)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714163Species Pseudomonas aeruginosa [TaxId:388272] [226355] (3 PDB entries)
  8. 2714167Domain d4ecia2: 4eci A:82-203 [220415]
    Other proteins in same PDB: d4ecia1, d4ecia3, d4ecib1, d4ecib3
    automated match to d1k0db1
    complexed with act

Details for d4ecia2

PDB Entry: 4eci (more details), 1.8 Å

PDB Description: Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with acetate
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4ecia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ecia2 a.45.1.0 (A:82-203) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
lmpadvkgrsrviqwlmfqmggvgpmqgqanvffryfpeklqgaidryqhetrrlyevld
grlgeaeylagdysiadiatypwvrihdwsgvavdgldnlqrwiaaiearpavqrgllvp
rr

SCOPe Domain Coordinates for d4ecia2:

Click to download the PDB-style file with coordinates for d4ecia2.
(The format of our PDB-style files is described here.)

Timeline for d4ecia2: