| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:388272] [226354] (3 PDB entries) |
| Domain d4ecia1: 4eci A:1-81 [220414] Other proteins in same PDB: d4ecia2, d4ecia3, d4ecib2, d4ecib3 automated match to d1k0db2 complexed with act |
PDB Entry: 4eci (more details), 1.8 Å
SCOPe Domain Sequences for d4ecia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ecia1 c.47.1.0 (A:1-81) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
midlytaatpnghkvsialeemglpyrvhalsfdkkeqkapeflrinpngripaivdrdn
ddfavfesgailiylaektgq
Timeline for d4ecia1: