SCOPe 2.06: Domain d4ec0b2: 4ec0 B:1076-1199

Lineage for d4ec0b2 (4ec0 B:1076-1199)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (42 PDB entries)

8. Domain d4ec0b2: 4ec0 B:1076-1199 [220413]
   Other proteins in same PDB: d4ec0a1, d4ec0b1, d4ec0b3
   automated match to d1pd211
   complexed with 7pq, gsh, mg

Details for d4ec0b2

PDB Entry: 4ec0, 1.85 Å

PDB Description: crystal structure of hh-pgds with water displacing inhibitor

PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4ec0b2:

Sequence; same for both SEQRES and ATOM records:

>d4ec0b2 a.45.1.1 (B:1076-1199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d4ec0b2:

• d4ec0b2 first appeared in SCOPe 2.03
  
• d4ec0b2 appears in SCOPe 2.05
  
• d4ec0b2 appears in SCOPe 2.07
  
• d4ec0b2 appears in the current release, SCOPe 2.08