Lineage for d4ec0b1 (4ec0 B:1001-1075)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134369Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2134459Domain d4ec0b1: 4ec0 B:1001-1075 [220412]
    Other proteins in same PDB: d4ec0a2, d4ec0b2, d4ec0b3
    automated match to d1pd212
    complexed with 7pq, gsh, mg

Details for d4ec0b1

PDB Entry: 4ec0 (more details), 1.85 Å

PDB Description: crystal structure of hh-pgds with water displacing inhibitor
PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d4ec0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ec0b1 c.47.1.0 (B:1001-1075) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
lhqslaiaryltknt

SCOPe Domain Coordinates for d4ec0b1:

Click to download the PDB-style file with coordinates for d4ec0b1.
(The format of our PDB-style files is described here.)

Timeline for d4ec0b1: