Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries) |
Domain d4ec0b1: 4ec0 B:1001-1075 [220412] Other proteins in same PDB: d4ec0a2, d4ec0b2, d4ec0b3 automated match to d1pd212 complexed with 7pq, gsh, mg |
PDB Entry: 4ec0 (more details), 1.85 Å
SCOPe Domain Sequences for d4ec0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ec0b1 c.47.1.0 (B:1001-1075) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt lhqslaiaryltknt
Timeline for d4ec0b1: