SCOP 1.73: Domain d1cd9b1: 1cd9 B:1-107

Lineage for d1cd9b1 (1cd9 B:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)

8. Domain d1cd9b1: 1cd9 B:1-107 [22041]
   Other proteins in same PDB: d1cd9a_, d1cd9c_

Details for d1cd9b1

PDB Entry: 1cd9, 2.8 Å

PDB Description: 2:2 complex of g-csf with its receptor

PDB Compounds: (B:) protein (g-csf receptor)

SCOP Domain Sequences for d1cd9b1:

Sequence; same for both SEQRES and ATOM records:

>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
agyppaspsnlsclmhlttnslvcqwepgpethlptsfilksfrsradcqyqgdtipdcv
akkrqnncsiprknlllyqymaiwvqaenmlgssespklcldpmdvv

Timeline for d1cd9b1:

• d1cd9b1 first appeared (with stable ids) in SCOP 1.55
  
• d1cd9b1 appears in SCOP 1.71
  
• d1cd9b1 appears in SCOP 1.75
  
• d1cd9b1 appears in the current release, SCOPe 2.08