Lineage for d4eb7b_ (4eb7 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614369Species Archaeoglobus fulgidus [TaxId:224325] [196899] (4 PDB entries)
  8. 1614375Domain d4eb7b_: 4eb7 B: [220404]
    Other proteins in same PDB: d4eb7c_
    automated match to d4hvka_
    complexed with epe, fes, gol, plp

Details for d4eb7b_

PDB Entry: 4eb7 (more details), 2.75 Å

PDB Description: A. fulgidus IscS-IscU complex structure
PDB Compounds: (B:) Probable cysteine desulfurase 2

SCOPe Domain Sequences for d4eb7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eb7b_ c.67.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
evdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
esivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvdr
llevlpgvierlrsmsp

SCOPe Domain Coordinates for d4eb7b_:

Click to download the PDB-style file with coordinates for d4eb7b_.
(The format of our PDB-style files is described here.)

Timeline for d4eb7b_: