![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:224325] [196899] (4 PDB entries) |
![]() | Domain d4eb7b_: 4eb7 B: [220404] Other proteins in same PDB: d4eb7c_ automated match to d4hvka_ complexed with epe, fes, gol, plp |
PDB Entry: 4eb7 (more details), 2.75 Å
SCOPe Domain Sequences for d4eb7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eb7b_ c.67.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi evdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg esivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvdr llevlpgvierlrsmsp
Timeline for d4eb7b_: