SCOPe 2.06: Domain d4eb5d_: 4eb5 D:

Lineage for d4eb5d_ (4eb5 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.0: automated matches [191547] (1 protein)
   not a true family

6. Protein automated matches [190942] (5 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:224325] [226363] (2 PDB entries)

8. Domain d4eb5d_: 4eb5 D: [220402]
   Other proteins in same PDB: d4eb5a_, d4eb5b_
   automated match to d1r9pa_
   complexed with epe, fes, gol, plp

Details for d4eb5d_

PDB Entry: 4eb5, 2.53 Å

PDB Description: A. fulgidus IscS-IscU complex structure

PDB Compounds: (D:) NifU protein (NifU-1)

SCOPe Domain Sequences for d4eb5d_:

Sequence; same for both SEQRES and ATOM records:

>d4eb5d_ d.224.1.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
ysdkvfdhfqnprnvgkiedadgvgtvgnpvcgdlmtiyikvkdnriedikfqtfgcaaa
iatssmatemakgktieealkitrdavaealgglpkqkmhcsnlaadalrraivdyfrkn
gkidkikelglekelekm

Timeline for d4eb5d_:

• d4eb5d_ first appeared in SCOPe 2.03
  
• d4eb5d_ appears in SCOPe 2.05
  
• d4eb5d_ appears in SCOPe 2.07
  
• d4eb5d_ appears in the current release, SCOPe 2.08