SCOP 1.73: Domain d1c8pa_: 1c8p A:

Lineage for d1c8pa_ (1c8p A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
   duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3

7. Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries)

8. Domain d1c8pa_: 1c8p A: [22040]
   domain 4, the ligand-binding domain

Details for d1c8pa_

PDB Entry: 1c8p

PDB Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors

PDB Compounds: (A:) cytokine receptor common beta chain

SCOP Domain Sequences for d1c8pa_:

Sequence; same for both SEQRES and ATOM records:

>d1c8pa_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
malpalepstrywarvrvrtsrtgyngiwsewsearswdtes

Timeline for d1c8pa_:

• d1c8pa_ first appeared (with stable ids) in SCOP 1.55
  
• d1c8pa_ appears in SCOP 1.71
  
• d1c8pa_ appears in SCOP 1.75
  
• d1c8pa_ appears in the current release, SCOPe 2.07, called d1c8pa1