Lineage for d1c8pa_ (1c8p A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) 
Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries) 
Domain d1c8pa_: 1c8p A: [22040]
Details for d1c8pa_
PDB Entry: 1c8p (more details)
PDB Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
SCOP Domain Sequences for d1c8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8pa_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)}
miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
malpalepstrywarvrvrtsrtgyngiwsewsearswdtes
SCOP Domain Coordinates for d1c8pa_:
Click to download the PDB-style file with coordinates for d1c8pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c8pa_:
- d1c8pa_ first appeared (with stable ids) in SCOP 1.55
- d1c8pa_ appears in SCOP 1.57
- d1c8pa_ appears in SCOP 1.61
- d1c8pa_ appears in the current release, SCOPe 2.08, called d1c8pa1
View in 3D