Lineage for d4eanb_ (4ean B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083096Species Sulfolobus solfataricus [TaxId:273057] [195161] (4 PDB entries)
  8. 2083100Domain d4eanb_: 4ean B: [220392]
    automated match to d4eamb_
    complexed with cl, ind, mpd

Details for d4eanb_

PDB Entry: 4ean (more details), 1.75 Å

PDB Description: 1.75a resolution structure of indole bound beta-glycosidase (w33g) from sulfolobus solfataricus
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4eanb_:

Sequence, based on SEQRES records: (download)

>d4eanb_ c.1.8.4 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

Sequence, based on observed residues (ATOM records): (download)

>d4eanb_ c.1.8.4 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitk
ivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweff
peglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgylh
wsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppv
kplrh

SCOPe Domain Coordinates for d4eanb_:

Click to download the PDB-style file with coordinates for d4eanb_.
(The format of our PDB-style files is described here.)

Timeline for d4eanb_: