Lineage for d4eana_ (4ean A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340480Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 1340635Protein automated matches [190245] (6 species)
    not a true protein
  7. 1340645Species Sulfolobus solfataricus [TaxId:273057] [195161] (2 PDB entries)
  8. 1340648Domain d4eana_: 4ean A: [220391]
    automated match to d4eamb_
    complexed with cl, ind, mpd

Details for d4eana_

PDB Entry: 4ean (more details), 1.75 Å

PDB Description: 1.75a resolution structure of indole bound beta-glycosidase (w33g) from sulfolobus solfataricus
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4eana_:

Sequence, based on SEQRES records: (download)

>d4eana_ c.1.8.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

Sequence, based on observed residues (ATOM records): (download)

>d4eana_ c.1.8.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpfdeskqdvteveinenelkrldeya
nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrki
vrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffp
eglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgylhw
sladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvk
plrh

SCOPe Domain Coordinates for d4eana_:

Click to download the PDB-style file with coordinates for d4eana_.
(The format of our PDB-style files is described here.)

Timeline for d4eana_: