Lineage for d1egja_ (1egj A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297328Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1297329Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1297337Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 1297338Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries)
  8. 1297347Domain d1egja_: 1egj A: [22039]
    Other proteins in same PDB: d1egjh1, d1egjh2, d1egjl1, d1egjl2
    domain 4, the ligand-binding domain; complex with Fab
    complexed with nag

Details for d1egja_

PDB Entry: 1egj (more details), 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody
PDB Compounds: (A:) cytokine receptor common beta chain precursor

SCOPe Domain Sequences for d1egja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egja_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm
alpalepstrywarvrvrtsrtgyngiwsewsearswdtes

SCOPe Domain Coordinates for d1egja_:

Click to download the PDB-style file with coordinates for d1egja_.
(The format of our PDB-style files is described here.)

Timeline for d1egja_: