![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (20 proteins) |
![]() | Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species) duplication: consists of four similar domains; dimerises by swapping the C-terminal strands of domains 1 and 3 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries) |
![]() | Domain d1egja_: 1egj A: [22039] Other proteins in same PDB: d1egjh1, d1egjh2, d1egjl1, d1egjl2 domain 4, the ligand-binding domain; complex with Fab complexed with nag |
PDB Entry: 1egj (more details), 2.8 Å
SCOP Domain Sequences for d1egja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egja_ b.1.2.1 (A:) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)} iqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahsm alpalepstrywarvrvrtsrtgyngiwsewsearswdtes
Timeline for d1egja_:
![]() Domains from other chains: (mouse over for more information) d1egjh1, d1egjh2, d1egjl1, d1egjl2 |