![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) ![]() automatically mapped to Pfam PF00591 |
![]() | Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins) |
![]() | Protein Thymidine phosphorylase [52420] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52421] (7 PDB entries) |
![]() | Domain d4eafa2: 4eaf A:71-335 [220389] Other proteins in same PDB: d4eafa1, d4eafa3, d4eafa4 automated match to d2tpta2 complexed with gol, so4 |
PDB Entry: 4eaf (more details), 1.55 Å
SCOPe Domain Sequences for d4eafa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eafa2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa evfgrmvaaqkgptdfvenyakylp
Timeline for d4eafa2: