![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
![]() | Protein Thymidine phosphorylase [47650] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [47651] (7 PDB entries) |
![]() | Domain d4eafa1: 4eaf A:2-70 [220388] Other proteins in same PDB: d4eafa2, d4eafa3, d4eafa4 automated match to d2tpta1 complexed with gol, so4 |
PDB Entry: 4eaf (more details), 1.55 Å
SCOPe Domain Sequences for d4eafa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eafa1 a.46.2.1 (A:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm amrdsgtvl
Timeline for d4eafa1: