SCOPe 2.03: Domain d4e92b_: 4e92 B:

Lineage for d4e92b_ (4e92 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (25 PDB entries)

8. Domain d4e92b_: 4e92 B: [220379]
   automated match to d1m9cc_
   complexed with 0oe, 0og

Details for d4e92b_

PDB Entry: 4e92, 1.8 Å

PDB Description: Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With Inhibitor BM4

PDB Compounds: (B:) gag protein

SCOPe Domain Sequences for d4e92b_:

Sequence, based on SEQRES records:

>d4e92b_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Sequence, based on observed residues (ATOM records):

>d4e92b_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmys

Timeline for d4e92b_:

• d4e92b_ is new in SCOPe 2.03-stable
  
• d4e92b_ appears in SCOPe 2.04
  
• d4e92b_ appears in the current release, SCOPe 2.08