Lineage for d4e92b_ (4e92 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000672Protein HIV-1 capsid protein [47945] (1 species)
  7. 2000673Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)
  8. 2000691Domain d4e92b_: 4e92 B: [220379]
    automated match to d1m9cc_
    complexed with 0oe, 0og

Details for d4e92b_

PDB Entry: 4e92 (more details), 1.8 Å

PDB Description: Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With Inhibitor BM4
PDB Compounds: (B:) gag protein

SCOPe Domain Sequences for d4e92b_:

Sequence, based on SEQRES records: (download)

>d4e92b_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Sequence, based on observed residues (ATOM records): (download)

>d4e92b_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhgqmreprgsdiagttstlqeqigwmthnppipv
geiykrwiilglnkivrmys

SCOPe Domain Coordinates for d4e92b_:

Click to download the PDB-style file with coordinates for d4e92b_.
(The format of our PDB-style files is described here.)

Timeline for d4e92b_: