SCOPe 2.07: Domain d4e8ob1: 4e8o B:1-146

Lineage for d4e8ob1 (4e8o B:1-146)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [226348] (1 PDB entry)

8. Domain d4e8ob1: 4e8o B:1-146 [220377]
   Other proteins in same PDB: d4e8oa2, d4e8ob2
   automated match to d1s5ka_
   complexed with cl

Details for d4e8ob1

PDB Entry: 4e8o, 2.14 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ih from acinetobacter baumannii

PDB Compounds: (B:) Aac(6')-Ih protein

SCOPe Domain Sequences for d4e8ob1:

Sequence; same for both SEQRES and ATOM records:

>d4e8ob1 d.108.1.0 (B:1-146) automated matches {Acinetobacter baumannii [TaxId: 470]}
mnimpisesqlsdwlalrcllwpdhedvhlqemrqlitqahrlqllaytdtqqaiamlea
siryeyvngtqtspvaflegifvlpeyrrsgiatglvqqveiwakqfactefasdaaldn
qishamhqalgfhetervvyfkknig

Timeline for d4e8ob1:

• d4e8ob1 first appeared in SCOPe 2.03, called d4e8ob_
  
• d4e8ob1 appears in SCOPe 2.06
  
• d4e8ob1 appears in the current release, SCOPe 2.08