Lineage for d1iarb1 (1iar B:1-96)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105380Protein Interleukin-4 receptor alpha chain [49287] (1 species)
  7. 105381Species Human (Homo sapiens) [TaxId:9606] [49288] (1 PDB entry)
  8. 105382Domain d1iarb1: 1iar B:1-96 [22037]
    Other proteins in same PDB: d1iara_

Details for d1iarb1

PDB Entry: 1iar (more details), 2.3 Å

PDB Description: interleukin-4 / receptor alpha chain complex

SCOP Domain Sequences for d1iarb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iarb1 b.1.2.1 (B:1-96) Interleukin-4 receptor alpha chain {Human (Homo sapiens)}
fkvlqeptcvsdymsistcewkmngptncstelrllyqlvfllseahtcipennggagcv
chllmddvvsadnytldlwagqqllwkgsfkpsehv

SCOP Domain Coordinates for d1iarb1:

Click to download the PDB-style file with coordinates for d1iarb1.
(The format of our PDB-style files is described here.)

Timeline for d1iarb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iarb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1iara_