SCOPe 2.08: Domain d1iarb1: 1iar B:1-96

Lineage for d1iarb1 (1iar B:1-96)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interleukin-4 receptor alpha chain [49287] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49288] (1 PDB entry)

8. Domain d1iarb1: 1iar B:1-96 [22037]
   Other proteins in same PDB: d1iara_

Details for d1iarb1

PDB Entry: 1iar, 2.3 Å

PDB Description: interleukin-4 / receptor alpha chain complex

PDB Compounds: (B:) protein (interleukin-4 receptor alpha chain)

SCOPe Domain Sequences for d1iarb1:

Sequence; same for both SEQRES and ATOM records:

>d1iarb1 b.1.2.1 (B:1-96) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
fkvlqeptcvsdymsistcewkmngptncstelrllyqlvfllseahtcipennggagcv
chllmddvvsadnytldlwagqqllwkgsfkpsehv

Timeline for d1iarb1:

• d1iarb1 first appeared (with stable ids) in SCOP 1.55
  
• d1iarb1 appears in SCOPe 2.07