Lineage for d4e8eb1 (4e8e B:1-89)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880286Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (9 PDB entries)
  8. 2880302Domain d4e8eb1: 4e8e B:1-89 [220362]
    Other proteins in same PDB: d4e8ea2, d4e8ea3, d4e8eb2, d4e8eb3, d4e8ec2, d4e8ec3, d4e8ed2, d4e8ed3
    automated match to d1r5aa2

Details for d4e8eb1

PDB Entry: 4e8e (more details), 2.51 Å

PDB Description: Structural characterization of Bombyx mori glutathione transferase BmGSTD1
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4e8eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e8eb1 c.47.1.0 (B:1-89) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
mpvqpiklyylppsppcravmmtarvleldlhlittnimngehmtpeylkmnpqhtiptm
ddngfilwesraiqtylvnaygkddslyp

SCOPe Domain Coordinates for d4e8eb1:

Click to download the PDB-style file with coordinates for d4e8eb1.
(The format of our PDB-style files is described here.)

Timeline for d4e8eb1: