SCOPe 2.06: Domain d1f6fc2: 1f6f C:101-204

Lineage for d1f6fc2 (1f6f C:101-204)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Prolactin receptor [49284] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry)

8. Domain d1f6fc2: 1f6f C:101-204 [22036]
   Other proteins in same PDB: d1f6fa_

Details for d1f6fc2

PDB Entry: 1f6f, 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor

PDB Compounds: (C:) Prolactin receptor

SCOPe Domain Sequences for d1f6fc2:

Sequence, based on SEQRES records:

>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vepepprnltlevkqlkdkktylwvkwspptitdvktgwftmeyeirlkpeeaeeweihf
tghqtqfkvfdlypgqkylvqtrckpdhgywsrwsqessvempn

Sequence, based on observed residues (ATOM records):

>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vepepprnltlevkktylwvkwspptmeyeirlkeweihftghqtqfkvfdlypgqkylv
qtrckpdhgywsrwsqessvempn

Timeline for d1f6fc2:

• d1f6fc2 first appeared (with stable ids) in SCOP 1.55
  
• d1f6fc2 appears in SCOPe 2.05
  
• d1f6fc2 appears in SCOPe 2.07
  
• d1f6fc2 appears in the current release, SCOPe 2.08