| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:171101] [226388] (5 PDB entries) |
| Domain d4e7pb1: 4e7p B:1-130 [220357] Other proteins in same PDB: d4e7pa2, d4e7pb2 automated match to d3ffwa_ complexed with bef, mg |
PDB Entry: 4e7p (more details), 1.89 Å
SCOPe Domain Sequences for d4e7pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e7pb1 c.23.1.0 (B:1-130) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
mkvlvaedqsmlrdamcqlltlqpdvesvlqakngqeaiqllekesvdiaildvempvkt
glevlewirsekletkvvvvttfkragyferavkagvdayvlkersiadlmqtlhtvleg
rkeyspelme
Timeline for d4e7pb1: