SCOP 1.61: Domain d1f6fc1: 1f6f C:6-100

Lineage for d1f6fc1 (1f6f C:6-100)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Prolactin receptor [49284] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry)

8. Domain d1f6fc1: 1f6f C:6-100 [22035]
   Other proteins in same PDB: d1f6fa_

Details for d1f6fc1

PDB Entry: 1f6f, 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor

SCOP Domain Sequences for d1f6fc1:

Sequence, based on SEQRES records:

>d1f6fc1 b.1.2.1 (C:6-100) Prolactin receptor {Rat (Rattus norvegicus)}
kpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpnscffs
kqytsiwkiyiitvnatnqmgssssdplyvdvtyi

Sequence, based on observed residues (ATOM records):

>d1f6fc1 b.1.2.1 (C:6-100) Prolactin receptor {Rat (Rattus norvegicus)}
kpeihkcrspdketftcwwnpgttnysltyskegekttyecpdyktsgpnscffskqyts
iwkiyiitvnatsssdplyvdvtyi

Timeline for d1f6fc1:

• d1f6fc1 first appeared (with stable ids) in SCOP 1.55
  
• d1f6fc1 appears in SCOP 1.59
  
• d1f6fc1 appears in SCOP 1.63
  
• d1f6fc1 appears in the current release, SCOPe 2.08