Lineage for d4e6ra1 (4e6r A:114-170)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783528Domain d4e6ra1: 4e6r A:114-170 [220339]
    Other proteins in same PDB: d4e6ra2, d4e6rb2
    automated match to d3ulrb_
    complexed with imd, unl, zn

Details for d4e6ra1

PDB Entry: 4e6r (more details), 2.2 Å

PDB Description: crystal structure of a cytoplasmic protein nck2 (nck2) from homo sapiens at 2.20 a resolution
PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d4e6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6ra1 b.34.2.0 (A:114-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipafvkfayvaeredelslvkgsrvtvmekcsdgwwrgsyngqigwfpsnyvleevd

SCOPe Domain Coordinates for d4e6ra1:

Click to download the PDB-style file with coordinates for d4e6ra1.
(The format of our PDB-style files is described here.)

Timeline for d4e6ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e6ra2