SCOPe 2.08: Domain d4e6ra1: 4e6r A:114-170

Lineage for d4e6ra1 (4e6r A:114-170)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d4e6ra1: 4e6r A:114-170 [220339]
   Other proteins in same PDB: d4e6ra2, d4e6rb2
   automated match to d3ulrb_
   complexed with imd, unl, zn

Details for d4e6ra1

PDB Entry: 4e6r, 2.2 Å

PDB Description: crystal structure of a cytoplasmic protein nck2 (nck2) from homo sapiens at 2.20 a resolution

PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d4e6ra1:

Sequence; same for both SEQRES and ATOM records:

>d4e6ra1 b.34.2.0 (A:114-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipafvkfayvaeredelslvkgsrvtvmekcsdgwwrgsyngqigwfpsnyvleevd

Timeline for d4e6ra1:

• d4e6ra1 first appeared in SCOPe 2.03, called d4e6ra_
  
• d4e6ra1 appears in SCOPe 2.07