Lineage for d4e6mf1 (4e6m F:0-122)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412715Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1412964Protein Putative dehydratase protein STM2273 [143250] (2 species)
  7. 1412965Species Salmonella enterica [TaxId:90371] [226346] (1 PDB entry)
  8. 1412971Domain d4e6mf1: 4e6m F:0-122 [220333]
    Other proteins in same PDB: d4e6ma2, d4e6mb2, d4e6mc2, d4e6md2, d4e6me2, d4e6mf2, d4e6mg2, d4e6mh2
    automated match to d2gl5a2
    complexed with epe, mg, mpd

Details for d4e6mf1

PDB Entry: 4e6m (more details), 1.8 Å

PDB Description: Crystal structure of Putative dehydratase protein from Salmonella enterica subsp. enterica serovar Typhimurium (Salmonella typhimurium)
PDB Compounds: (F:) putative dehydratase protein

SCOPe Domain Sequences for d4e6mf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6mf1 d.54.1.1 (F:0-122) Putative dehydratase protein STM2273 {Salmonella enterica [TaxId: 90371]}
mmkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiird
laplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyql
lgg

SCOPe Domain Coordinates for d4e6mf1:

Click to download the PDB-style file with coordinates for d4e6mf1.
(The format of our PDB-style files is described here.)

Timeline for d4e6mf1: