Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
Protein Putative dehydratase protein STM2273 [143250] (2 species) |
Species Salmonella enterica [TaxId:90371] [226346] (1 PDB entry) |
Domain d4e6mf1: 4e6m F:0-122 [220333] Other proteins in same PDB: d4e6ma2, d4e6mb2, d4e6mc2, d4e6md2, d4e6me2, d4e6mf2, d4e6mg2, d4e6mh2 automated match to d2gl5a2 complexed with epe, mg, mpd |
PDB Entry: 4e6m (more details), 1.8 Å
SCOPe Domain Sequences for d4e6mf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e6mf1 d.54.1.1 (F:0-122) Putative dehydratase protein STM2273 {Salmonella enterica [TaxId: 90371]} mmkitsievfdcelkkrdqtmssynpvlirvntdsglsgigevglaygagakagvgiird laplivgedplniekiwefffrktfwgmgggnvfyagmsaidialwdikgkylgvpvyql lgg
Timeline for d4e6mf1: