Lineage for d1f6fb1 (1f6f B:5-100)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54879Protein Prolactin receptor [49284] (2 species)
  7. 54883Species Rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry)
  8. 54884Domain d1f6fb1: 1f6f B:5-100 [22033]
    Other proteins in same PDB: d1f6fa_

Details for d1f6fb1

PDB Entry: 1f6f (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor

SCOP Domain Sequences for d1f6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus)}
gkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpnscff
skqytsiwkiyiitvnatnqmgssssdplyvdvtyi

SCOP Domain Coordinates for d1f6fb1:

Click to download the PDB-style file with coordinates for d1f6fb1.
(The format of our PDB-style files is described here.)

Timeline for d1f6fb1: