Lineage for d1f6fb1 (1f6f B:5-100)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762094Protein Prolactin receptor [49284] (2 species)
  7. 2762098Species Norway rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry)
  8. 2762099Domain d1f6fb1: 1f6f B:5-100 [22033]
    Other proteins in same PDB: d1f6fa_

Details for d1f6fb1

PDB Entry: 1f6f (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor
PDB Compounds: (B:) Prolactin receptor

SCOPe Domain Sequences for d1f6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpnscff
skqytsiwkiyiitvnatnqmgssssdplyvdvtyi

SCOPe Domain Coordinates for d1f6fb1:

Click to download the PDB-style file with coordinates for d1f6fb1.
(The format of our PDB-style files is described here.)

Timeline for d1f6fb1: