| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Prolactin receptor [49284] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry) |
| Domain d1f6fb1: 1f6f B:5-100 [22033] Other proteins in same PDB: d1f6fa_ |
PDB Entry: 1f6f (more details), 2.3 Å
SCOPe Domain Sequences for d1f6fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gkpeihkcrspdketftcwwnpgtdgglptnysltyskegekttyecpdyktsgpnscff
skqytsiwkiyiitvnatnqmgssssdplyvdvtyi
Timeline for d1f6fb1: